Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
  • 1
    Unknown
    New York, NY : Springer
    Keywords: Neurosciences ; Proteomics ; Neurosciences ; Proteomics ; Springer eBooks
    Description / Table of Contents: Neuroproteomics: The Methods -- Dissection of Rodent Brain Regions: Guided Free-Hand Slicing and Dissection of Frozen Tissue -- Isolation of Synapse Sub-Domains by Subcellular Fractionation Using Sucrose Density Gradient Centrifugation: Purification of the Synaptosome, Synaptic Plasma Membrane, Postsynaptic Density, Synaptic Membrane Raft, and Postsynaptic Density Lattice -- Laser Microdissection for Spatial Proteomics of Post Mortem Brain Tissue -- High pH Reversed-Phase Pre-Fractionation for In-Depth Shotgun Proteomics -- Sample Preparation for Proteomics Analysis: Filter-Aided Sample Preparation (FASP) and Single-Pot Solid-Phase Sample Preparation (SP3) -- Enrichment of Low-Molecular-Weight Phosphorylated Biomolecules Using Phos-Tag Tip -- Integrated Immunoprecipitation: Blue Native Gel Electrophoresis - Mass Spectrometry for the Identification of Protein Sub-Complexes -- Analysis of Synaptic Protein-Protein Interaction by Crosslinking-Mass Spectrometry -- TMT-MS3 Enabled Proteomic Quantification of Human IPSC Derived Neurons -- Data Independent Acquisition (SWATH) Mass Spectrometry Analysis of Protein Content in Primary Neuronal Cultures -- Quantitative Analysis of Mass Spectrometry-Based Proteomics Data -- 2D-DIGE as a Tool in Neuroproteomics -- Neuropeptidomics of the Mammalian Brain -- MALDI Imaging Mass Spectrometry - Neurochemical Imaging of Proteins and Peptides -- A Combined Cellomics and Proteomics Approach to Uncover Neuronal Pathways to Psychiatric Disorder
    Abstract: This second edition volume expands on the previous edition with updates on the latest techniques used in the field of proteomics. Tissue and cellular proteins are now being analyzed at near proteome-wide levels and mass spectrometers are achieving higher sensitivity and speed, resolution, and accuracy. The chapters in this book cover various new methods used in proteomic workflows such as laser microdissection for spatial proteomics of post-mortem brain tissue, sample preparation in single vessel with FASP and SP3 protocols, the crosslinking mass spectrometry, TMT-MS3 based proteomic with synchronous precursor selection, mass spectrometric data dependent acquisition (DDA) and data independent acquisition (DIA, SWATH) methods, 2D-DIGE, and MALDI Imaging Mass Spectrometry. In Neuromethods series style, chapters include the kind of detail and key advice from the specialists needed to get successful results in your laboratory. Cutting-edge and comprehensive, Neuroproteomics, Second Edition is a valuable guide that help researchers obtain the finest results from current proteomics platforms
    Pages: XIII, 218 p. 55 illus., 37 illus. in color. : online resource.
    Edition: 2nd ed. 2019.
    ISBN: 9781493996629
    Signatur Availability
    BibTip Others were also interested in ...
  • 2
    ISSN: 1471-4159
    Source: Blackwell Publishing Journal Backfiles 1879-2005
    Topics: Medicine
    Notes: Abstract: Male copulatory behavior in the snail Lymnaea stagnalis is controlled by several types of peptidergic neurons, including a cluster of neurons in the ventral lobe of the right cerebral ganglion that show immunoreactivity to myomodulin-A of Aplysia and innervate the penis complex. We identified structurally myomodulin-A and three related peptides from Lymnaea and showed that they are present in a characteristic ratio in both the penis nerve and penis complex, suggesting that they are processed from a single precursor and transported from the ventral lobe to the penis complex. All four peptides decreased the relaxation time of electrically evoked contractions of the penis retractor muscle. However, their effects on the amplitude of contraction were different, ranging from no effect to an increase or a decrease in the amplitude. A mixture of the peptides in a ratio as determined by direct mass spectrometry of the penis nerve decreased the contraction time, the relaxation time, and the amplitude. These effects resemble those of one particular peptide in the mixture. The direct mass spectrometry determinations of the peptide profile in the penis nerve suggest that many more, as yet unidentified, neuropeptides are involved in modulation of muscle activities of the penis complex.
    Type of Medium: Electronic Resource
    Signatur Availability
    BibTip Others were also interested in ...
  • 3
    ISSN: 1471-4159
    Source: Blackwell Publishing Journal Backfiles 1879-2005
    Topics: Medicine
    Notes: Abstract: We have identified two novel peptide toxins from molluscivorous Conus species that discriminate subtypes of high voltage-activated (HVA) calcium currents in molluscan neurons. The toxins were purified using assays on HVA calcium currents in the caudodorsal cells (CDCs) of the snail Lymnaea stagnalis. The CDC HVA current consists of a rapidly inactivating, transient current that is relatively insensitive to dihydropyridines (DHPs) and a slowly inactivating, DHP-sensitive L-current. The novel toxins, designated ω-conotoxins PnVIA and PnVIB, completely and selectively block the transient HVA current in CDCs with little (PnVIA) or no (PnVIB) effect on the sustained L-type current. The block is rapid and completely reversible. It is noteworthy that both PnVIA and PnVIB reveal very steep dose dependences of the block, which may imply cooperativity in toxin action. The amino acid sequences of PnVIA (GCLEVDYFCGIPFANNGLCCSGNCVFVCTPQ) and of PnVIB (DDDCEPPGNFCGMIKIGPPCCSGWCFFACA) show very little homology to previously described ω-conotoxins, although both toxins share the typical ω-conotoxin cysteine framework but have an unusual high content of hydrophobic residues and net negative charge. These novel ω-conotoxins will facilitate selective analysis of the functions of HVA calcium channels and may enable the rational design of drugs that are selective for relevant subtypes.
    Type of Medium: Electronic Resource
    Signatur Availability
    BibTip Others were also interested in ...
  • 4
    ISSN: 1573-6830
    Keywords: brain ; mollusk ; Helixcardioinhibitory peptide (HCIP) ; cardioactive ; peptide
    Source: Springer Online Journal Archives 1860-2000
    Topics: Biology
    Notes: Abstract 1. We report the isolation of a peptide from the brain of the snail Helix aspersa by radioimmunoassay using an antisomatostatin. 2. The sequencing of an immunopositive fraction showed the presence of a new tridecapeptide, termed Helix cardioinhibitory peptide (HCIP), with the following primary structure : H-Val-Phe-Gln-Asn-Gln-Phe-Lys-Gly-Ile-Gln-Gly-Arg-Phe-NH2. It is structurally related to the Achatina cardioexcitatory peptide (ACEP-1) and the terminal-ammo acid sequence of HCIP is identical to that of FMRFamide family peptides. 3. The synthetic HCIP was tested on heart and neuronal activities and it was found to have inhibitory actions not only on the ventricle but also on visceral neurons of the central nervous system of Helix. Immunocytochemical investigation indicates its presence in visceral and parietal ganglia, in which cells taking part in the regulation of the heartbeat have been previously identified .
    Type of Medium: Electronic Resource
    Signatur Availability
    BibTip Others were also interested in ...
  • 5
    ISSN: 1520-4995
    Source: ACS Legacy Archives
    Topics: Biology , Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Signatur Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...